128488-ML550
IMMT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52, DKFZp779P1653, MGC111146) (MaxLight 550)
Größe
£914.00
- SKU:
- 128488-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa481-581 from human IMMT (NP_006830) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Mitochondria are the center of cellular energy production and essential metabolic reactions. As double membrane-bound organelles, mitochondria from different species, tissues, and metabolic states are highly polymorphic in nature, yet exhibit common structural features. The ultrastructural variations in mitochondrial architecture occur mainly due to the differences in the amount and shape of cristae. Abundant cristae are found in mitochondria from tissues where energy demand is high. Analysis of the human heart mitochondrial proteome shows that mitofilin is one of the most abundant mitochondrial proteins. It appears to play an important role in the maintenance of cristae morphology. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice