128469-PE

IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (PE)

Größe

£914.00

SKU:: 128469-PE
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa63-153 from human IL4 (NP_000580) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: IL-4 is a potent lymphoid cell growth factor that stimulates the growth and survivability of certain B cells and T cells. Human IL-4 is a 15kD globular protein containing 130aa residues. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.