128469-BIOTIN

IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (Biotin)

Größe

£914.00

SKU:: 128469-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa63-153 from human IL4 (NP_000580) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: IL-4 is a potent lymphoid cell growth factor that stimulates the growth and survivability of certain B cells and T cells. Human IL-4 is a 15kD globular protein containing 130aa residues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.