128459-BIOTIN
IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25) (Biotin)
Größe
£914.00
- SKU:
- 128459-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa22-122 from human IL2RA (NP_000408) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- IL-2 receptor alpha (IL-2 RA), also known as CD25, is a 55kD type I membrane glycoprotein that belongs to a family of cytokine receptors that utilize the common gamma chain subunit (Gc). IL-2 RA is primarily expressed on activated T cells and on regulatory T cells (Treg). IL-2 RABBIT (CD122) and Gc (IL-2 RG/CD132) dimerize to form a constitutively expressed intermediate affinity IL-2 receptor. By itself, IL-2 RA binds IL-2 with low affinity. It associates with IL-2 RB and GC to generate a ternary high affinity IL-2 receptor complex. A soluble form of IL-2 RA can be generated by proteolytic cleavage of the cell surface receptor, rendering the T cell unresponsive to IL-2. Increased serum levels of soluble IL-2 RA are found in some cancers and immune disorders. IL-2 RA is required for activation-induced cell death (AICD) of naive T cells, a mechanism responsible for deleting autoreactive T cell clones. IL-2 RA is also required for the development of CD4+CD25+ Treg which suppress autoreactive CD4+ T cells, thereby contributing to peripheral T cell homeostasis. Within the ECD, canine IL-2 RA shares 49%-60% aa sequence identity with human, mouse, and rat IL-2 RA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice