IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151)

Größe

£685.00

SKU:: 128367
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa541-640 from IKBKE (NP_054721) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Nuclear factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB is associated with IkB proteins in the cell cytoplasm, which inhibit NF-kB activity. IkB is phosphorylated by IkB kinase (IKK) complex that contains IKKa, IKKb, and IKKg. A novel molecule in the IKK complex was recently identified and designated IKK-e/IKK-i. IKK-e is required for the activation of NF-kB by PMA and T cell receptors but not by TNFa and IL-1. IKK-e/IKK-i message is expressed in a variety of tissues and is inducible by TNFa, IL-1, and LPS. Applications: Suitable for use in Immunohistochemistry and ELISA. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice