128367-PE
IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151) (PE)
Größe
£914.00
- SKU:
- 128367-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa541-640 from IKBKE (NP_054721) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Nuclear factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB is associated with IkB proteins in the cell cytoplasm, which inhibit NF-kB activity. IkB is phosphorylated by IkB kinase (IKK) complex that contains IKKa, IKKb, and IKKg. A novel molecule in the IKK complex was recently identified and designated IKK-e/IKK-i. IKK-e is required for the activation of NF-kB by PMA and T cell receptors but not by TNFa and IL-1. IKK-e/IKK-i message is expressed in a variety of tissues and is inducible by TNFa, IL-1, and LPS. Applications: Suitable for use in Immunohistochemistry and FLISA. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice