128367-HRP

IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151) (HRP)

Größe

£914.00

SKU:: 128367-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa541-640 from IKBKE (NP_054721) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: Nuclear factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB is associated with IkB proteins in the cell cytoplasm, which inhibit NF-kB activity. IkB is phosphorylated by IkB kinase (IKK) complex that contains IKKa, IKKb, and IKKg. A novel molecule in the IKK complex was recently identified and designated IKK-e/IKK-i. IKK-e is required for the activation of NF-kB by PMA and T cell receptors but not by TNFa and IL-1. IKK-e/IKK-i message is expressed in a variety of tissues and is inducible by TNFa, IL-1, and LPS. Applications: Suitable for use in Immunohistochemistry and ELISA. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice