IGBP1 (IBP1, Immunoglobulin-binding Protein 1, B Cell Signal Transduction Molecule alpha 4, CD79a-binding Protein 1, Renal Carcinoma Antigen NY-REN-16)

Größe

£685.00

SKU:: 128328
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa64-165 from human IGBP1 (NP_001542) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.