IFNGR2 (Interferon gamma Receptor 2, IFN-gamma Receptor 2, IFN-gamma-R2, Interferon gamma Receptor Accessory Factor 1, AF-1, Interferon gamma Transducer 1, IFNGT1)

Größe

£685.00

SKU:: 128312
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa28-127 from human IFNGR2 (NP_005525.2) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.