128277-BIOTIN
IFNA2 (Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, MGC125764, MGC125765) (Biotin)
Größe
£934.00
- SKU:
- 128277-BIOTIN
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human IFNA2, aa-188 (NP_000596.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The IFNa family has pseudogenes in two families (I and II), one with a mature length of 166aa and one of 172aa. Cells producing IFNa are lymphocytes, monocytes, macrophages and cell lines such as Namalwa and KGI. Bioassays for IFNa include cytopathic effect blocking, by viruses such as VSV, SFV and BMCV, on their target cells. A number of receptors for IFNa are now known and seem to be expressed on most cell types. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice