128260-APC
IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) (APC)
Größe
£927.00
- SKU:
- 128260-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-133 from human IFITM3 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C8-1B10
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- FITM3 is a 14.6kD (predicted) member of the CD225 family of proteins. It is expressed on primordial germ cells and select tumor types, and appears to regulate cell migration. Human IFITM3 is a 133aa, two-transmembrene protein that contains an N-terminal aa1-57 and a C-terminal aa108-128 extracellular domain. Over aa3-57, human IFITM3 is 59% and 56% aa identical to bovine and mouse IFITM3, respectively. Over aa3-57 human IFITM3 is 88% identical to human IFITM2. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice