IDH3B (FLJ11043, Isocitrate Dehydrogenase [NAD] Subunit beta, Mitochondrial, Isocitric Dehydrogenase Subunit beta, NAD(+)-specific ICDH Subunit beta, MGC903)

Größe

£685.00

SKU:: 128210
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa296-384 from human IDH3B (NP_008830) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Defects in IDH3B are the cause of retinitis pigmentosa type 46 (RP46) [MIM:612572]. RP is a retinal dystrophy belonging to the group of pigmentary retinopathies. RP is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice