128197-PE
ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653) (PE)
Größe
£914.00
- SKU:
- 128197-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa20-303 from ICOSLG (AAH64637) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- B7-H2, or Inducible costimulator ligand (ICOSL), is a member of the Ig superfamily and belongs to the B7 family of costimulatory molecules. It specifically binds to ICOS, but not to other T cell costimulatory molecules such as CD28 and CTLA-4. B7-H2-ICOS interaction appears to be very important in the expansion of activated T cells and late-phase immune responses. B7-H2 enhances the proliferation of both CD4 and CD8 T cells, the secretion of Th1- and/or Th2-type cytokines, and the expression of CD154 (CD40 ligand) on T cells. It is expressed constitutively on B lymphocytes and at low levels on monocytes. Furthermore, B7-H2-ICOS interaction induces IL-10 production, which plays an important role in reducing immune responses. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice