128192
ICEBERG (Caspase Recruitment Domain-containing Protein 18, Caspase-1 Inhibitor Iceberg, CARD18, UNQ5804/PRO19611)
Größe
£685.00
- SKU:
- 128192
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human ICEBERG, aa1-90 (NP_067546.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- ICEBERG, an inhibitor of pro-caspase-1 activation, consists essentially of only a CARD. It inhibits generation of IL-1b by interacting with caspase-1 and preventing association with RIP2. The ICEBERG functions as a competitive antagonist of RIP2/pro-caspase-1 interactions and inhibits caspase-1-dependent pro-L-1b secretion in mononuclear cells. ICEBERG is induced by proinflammatory stimuli, suggesting that it may be part of a negative feedback loop. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice