128184
ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69)
Größe
£685.00
- SKU:
- 128184
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-110 from human ICA1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6G11
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice