HSPB8 (Heat Shock Protein beta-8, HspB8, Alpha-crystallin C Chain, E2-induced Gene 1 Protein, Protein Kinase H11, Small Stress Protein-like Protein HSP22, CRYAC, E2IG1, HSP22, PP1629)

Größe

£685.00

SKU:: 128140
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human HSPB8, aa1-196 (NP_055180.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Displays temperature-dependent chaperone activity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.