HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom)

Größe

£685.00

SKU:: 128126
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa561-641 from human HSPA1L (NP_005518) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HSPA1L is a 70kD heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.