128109
HSF2 (Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSTF2, MGC117376, MGC156196, MGC75048)
Größe
£685.00
- SKU:
- 128109
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-230 from human HSF2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F11-A3
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- HSF2 is a DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked. The protein is found as a DNA-binding homotrimer in stressed or heat shocked cells, and otherwise found as a homodimer. HSF2 is cytoplasmic during normal growth and moves to the nucleus upon activation. Sumoylation of HSF2 hinders HSF2 DNA-binding activity, without affecting its oligomerization, and is an example of negative regulation of gene expression via sumoylation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice