HSD17B8 (Estradiol 17-beta-dehydrogenase 8, 17-beta-hydroxysteroid Dehydrogenase 8, 17-beta-HSD 8, 3-oxoacyl-[acyl-carrier-protein] Reductase, Protein Ke6, Ke-6, Really Interesting New Gene 2 Protein, Testosterone 17-beta-dehydrogenase 8, FABGL, HKE6, RING2, SDR30C1, DJ1033B10.9) (Not for Export EU)

Größe

£760.00

SKU:: 128099
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human HSD17B8, aa1-261 (NP_055049.1).
Format:: Supplied as a liquid.
Weitere Details:: NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. Applications: Suitable for use in Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.