HSD17B14 (17-beta-hydroxysteroid Dehydrogenase 14, 17-beta-HSD 14, 17-beta-hydroxysteroid Dehydrogenase DHRS10, Dehydrogenase/Reductase SDR Family Member 10, Retinal Short-chain Dehydrogenase/Reductase retSDR3, DHRS10, SDR3, UNQ502/PRO474)

Größe

£685.00

SKU:: 128087
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human HSD17B14, aa1-270 (NP_057330.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HSD17b14 (hydroxysteroid (17beta)dehydrogenase type 14), also called 17bHSD14 or DHRS10, is a cytoplasmic 17beta hydroxy steroid dehydrogenase that is a member of the SDR (shortchain dehydrogenase/reductase) family. It is a 270aa, ~30kD protein with mRNA highly expressed in brain, placenta, liver and kidney. It converts estradiol to estrone, thus inactivating it, and is thought to regulate activity of estrogens and possibly dihydroepiandrosterone (DHEA) in the placenta and central nervous system. Human HSD17b14 shares 80.5% aa sequence identity with mouse and rat HSD17b14. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice