128064-PE

HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (PE)

Größe

£934.00

SKU:: 128064-PE
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human HRASLS3, aa1-162 (AAH01387.1).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: PLA2G16 specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. It also has a weak lysophospholipase activity (By similarity). Tumor suppressor that may be involved in interferon-dependent cell death. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.