HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I, MGC116843, MGC116844, MGC116845)

Größe

£685.00

SKU:: 128020
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-74 from human HOXB1 (NP_002135) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HOXB1 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It acts on the anterior body structures. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.