RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT)

Größe

£685.00

SKU:: 127981
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-90 from human RBMXL2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQATKPAFE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.