HLX1 (H2.0-like Homeobox Protein, Homeobox Protein HB24, Homeobox Protein HLX1, HLX)

Größe

£685.00

SKU:: 127941
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa176-279 from human HLX1 (NP_068777) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HLX1 homeobox protein (H2.0-like homeobox protein) is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. HLX1 is involved in embryogenesis and hematopoiesis and is located in the nucleus. HLX1 can be found at low levels in normal B and T-cells, and at high levels in activated lymphocytes and monocytes. HLX1 can also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain tissue. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.