HIPK2 (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593)

Größe

£685.00

SKU:: 127866
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa961-1065 from human HIPK2 (AAG41236) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HIPK2, a member of the KIPK subfamily of Ser/Thr protein kinases, phosphorylates homeodomain transcription factors. It may play a role as a corepressor for homeodomain transcription factors. This nuclear protein has been shown to interact with TRADD. It is highly expressed in neuronal tissues, heart and kidney, and weakly expressed in a ubiquitous way. HIPK2 is a target for sumoylation, and when conjugated it is directed to nuclear speckles Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.