127866-ML550

HIPK2 (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (MaxLight 550)

Größe

£914.00

SKU:: 127866-ML550
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa961-1065 from human HIPK2 (AAG41236) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Weitere Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. HIPK2, a member of the KIPK subfamily of Ser/Thr protein kinases, phosphorylates homeodomain transcription factors. It may play a role as a corepressor for homeodomain transcription factors. This nuclear protein has been shown to interact with TRADD. It is highly expressed in neuronal tissues, heart and kidney, and weakly expressed in a ubiquitous way. HIPK2 is a target for sumoylation, and when conjugated it is directed to nuclear speckles Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice