127865-ML490
HIPK1 (Homeodomain-interacting Protein Kinase 1, Nuclear Body-associated Kinase 2, KIAA0630, MYAK, NBAK2, MGC26642, MGC33446, MGC33548) (MaxLight 490)
Größe
£914.00
- SKU:
- 127865-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa330-430 from human HIPK1 (AAH28408) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. HIPK1, a nuclear serine/threonine kinase similar to the MNB/DYRK type protein kinases, has a conserved protein kinase domain that is separated from a domain that interacts with homeoproteins. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 35ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice