127854
HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase)
Größe
£685.00
- SKU:
- 127854
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-350 from human HIF1AN (AAH07719) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D8
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Factor inhibiting HIF-1 (FIH1) is an Fe (II)- dependent hydroxylase enzyme that serves as an oxygen sensor in the hypoxia response pathway. FIH1 binds to HIF-1alpha and inhibits its transactivation function. It also binds to VHL, which too functions as a transcriptional corepressor that inhibits HIF-1alpha transactivation function. In addition, FIH1 regulates the Notch signaling output and plays a role in how Notch signaling modulates the hypoxic response. It negatively regulates Notch activity and accelerates myogenic differentiation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice