HIF1A (Hypoxia-inducible Factor 1-alpha, HIF-1-alpha, HIF1-alpha, ARNT-interacting Protein, Basic-helix-loop-helix-PAS Protein MOP1, Class E Basic Helix-loop-helix Protein 78, bHLHe78, Member of PAS Protein 1, PAS Domain-containing Protein 8, BHLHE78, MOP1, PASD8)

Größe

£685.00

SKU:: 127853
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa717-826 from human HIF1A (NP_001521) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HIF-1a (Hypoxia-inducible factor 1a, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1a transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing.It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers,resulting in the activation of genes essential for cell survival. HIF-1a regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice