HHLA3 (HERV-H LTR-associating Protein 3, Human Endogenous Retrovirus-H Long Terminal Repeat-associating Protein 3)

Größe

£685.00

SKU:: 127847
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-54 from HHLA3 (NP_009002) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The function of this protein remains unknown but it may be involved in protein binding. There are 3 isoforms produced by alternative splicing. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.