HGD (Homogentisate 1,2-dioxygenase, AKU, FLJ94126, Homogentisate Oxygenase, Homogentisic Acid Oxidase, HGO, Homogentisicase)

Größe

£685.00

SKU:: 127839
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa377-445 from human HGD (NP_000178) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.