127830-ML490
HEY1 (Hairy/Enhancer-of-split Related with YRPW Motif Protein 1, Cardiovascular Helix-loop-helix Factor 2, CHF-2, Class B Basic Helix-loop-helix Protein 31, bHLHb31, HES-related Repressor Protein 1, Hairy and Enhancer of Split-related Protein 1, HESR-1, Hairy-related Transcription Factor 1, HRT-1, hHRT1, BHLHB31, CHF2, HERP2, HESR1, HRT1) (MaxLight 490)
Größe
£914.00
- SKU:
- 127830-ML490
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa121-220 from human HEY1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. HESR-1 belongs to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. It is a downstream effector of Notch signaling which may be required for cardiovascular development. It binds preferentially to the canonical E box sequence 5\'-CACGTG-3\'. It represses transcription by the the cardiac transcriptional activators GATA4 and GATA6. HESR1 is expressed in the somitic mesoderm, the central nervous system, the kidney, the heart, nasal epithelium, and limbs. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice