HES2 (Transcription Factor HES-2, Class B Basic Helix-loop-helix Protein 40, bHLHb40, Hairy and Enhancer of Split 2, BHLHB40)

Größe

£685.00

SKU:: 127812
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa41-114 from human HES2 (NP_061962) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Transcriptional repressor of genes that require a bHLH protein for their transcription. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.