127811-PE
HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (PE)
Größe
£914.00
- SKU:
- 127811-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa36-142 from human HES1 (NP_005515) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4D9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- HES1 is a transcriptional repressor of genes that require a bHLH protein for their transcription. It may act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. HES1 is expressed in developing neuroectodermal and endodermal endocrine tissues, and HES1 deficient embryos show severe defects in neuronal development, as well as pancreatic hypoplasia. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice