Hepatoma Derived Growth Factor (HDGF, DKFZp686J1764, FLJ96580, High-Mobility Group Protein 1-Like 2, HMG1L2, HMG-1L2)

Größe

£685.00

SKU:: 127802
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa184-240 from human HDGF (NP_004485) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: HDGF is a member of the hepatoma-derived growth factor family. This protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.