127745
HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase)
Größe
£685.00
- SKU:
- 127745
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-268 from human HCCS (AAH01691) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The precursor of cytochrome c, apocytochrome c, is synthesized in the cytoplasm. Upon translocation into mitochondria, cytochrome c acquires a heme moiety required for functionality in the mitochondrial respiration chain. The heme-bound form of cytochrome c is called holocytochrome c. When released into the cytosol, cytochrome c can activate caspases responsible for apoptosis. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCRTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice