127726
HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2)
Größe
£685.00
- SKU:
- 127726
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa30-134 from human HAPLN4 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1G5
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- HAPLN4 binds to hyaluronic acid and may be involved in formation of the extracellular matrix (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice