127711-BIOTIN
HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-CoA Dehydrogenase, SCHAD) (Biotin)
Größe
£914.00
- SKU:
- 127711-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa205-314 from human HADHSC (NP_005318) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- HADH, which belongs to the family of oxidoreductases, is important for converting certain fats to energy. This protein is an enzyme that catalyzes the chemical reaction. ((S)-3-hydroxyacyl-CoA + NAD+ <=>3-oxoacyl-CoA + NADH + H+ ) It is also involved in a process called fatty acid oxidation, in which several enzymes work in a step-wise fashion to break down (metabolize) fats and convert them to energy. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice