GTF2IRD1 (General Transcription Factor II-I Repeat Domain-containing Protein 1, GTF2I Repeat Domain-containing Protein 1, General Transcription Factor III, MusTRD1/BEN, Muscle TFII-I Repeat Domain-containing Protein 1, Slow-muscle-fiber Enhancer-binding Protein, USE B1-binding Protein, Williams-Beuren Syndrome Chromosomal Region 11 Protein, Williams-Beuren Syndrome Chromosomal Region 12 Protein, CREAM1, GTF3, MUSTRD1, RBAP2, WBSCR11, WBSCR12)

Größe

£685.00

SKU:: 127651
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa431-530 from GTF2IRD1 (NP_005676) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSED Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice