GTF2A2 (Transcription Initiation Factor IIA Subunit 2, General Transcription Factor IIA Subunit 2, TFIIA p12 Subunit, TFIIA-12, TFIIAS, Transcription Initiation Factor IIA gamma Chain, TFIIA-gamma, TF2A2)

Größe

£685.00

SKU:: 127628
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-109 from human GTF2A2 (AAH00287) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.