127614-BIOTIN
GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) (Biotin)
Größe
£914.00
- SKU:
- 127614-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-210 from human GSTP1 (AAH10915) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G6-F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Human glutathione S-transferases (GSTs) are a large multigene family of isoenzymes, which catalyse the conjugation of glutathione to electrophilic substrates. These enzymes are involved in the detoxification of both endogenous and exogenous electrophiles, which can react with cellular components such as DNA. The modification of DNA by reactive compounds can initiate carcinogenesis and the GSTs are believed to play a role in cancer prevention by inactivating carcinogens. There are four major structural classes of mammalian cytosolic GSTs (alpha, mu, pi and theta). Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice