GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303)

Größe

£685.00

SKU:: 127598
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa90-189 from human GSTM2 (NP_000839) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Applications: Suitable for use in ELISA, Western Blot, Immunofluorescence and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.