127583-ML550
GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (MaxLight 550)
Größe
£914.00
- SKU:
- 127583-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Glutathione reductase (GSR or GR) is a crucial flavoenzyme in the antioxidant defense system that maintains high levels of reduced glutathione in the cytosol. It belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family and is a flavoprotein homodimer of two equal subunits with one mole of noncovalently bound FAD in each subunit. GR reduces glutathione disulphide (GSSG) to the sulfhydryl form (GSH) which is an important cellular oxidant and is used by glutathione peroxidase to detoxify hydrogen peroxide. Apart from NADPH, GR also uses FAD as a cofactor for the process. In sperm, GR and glutathione peroxidase function as antioxidant enzymes and thus may inhibit lipid peroxidation. GR is stimulated by melatonin and is reportedly irreversibly inhibited by a number of oxygen radical generating systems. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice