127555-BIOTIN
GRM1 (Metabotropic Glutamate Receptor 1, mGluR1, GPRC1A, MGLUR1) (Biotin)
Größe
£914.00
- SKU:
- 127555-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa387-486 from human GRM1 (NP_000829) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice