GRAP2 (GRB2 Related Adaptor Protein 2, GRAP-2, GADS, GRB2-like Protein, GRB2L, GRBLG, GrbX, Grf40 Adapter Protein, Grf-40, GRID, Growth Factor Receptor Binding Protein, GRPL, Mona, p38, SH3-SH2-SH3 Adapter Mona) (Not for Export EU)

Größe

£760.00

SKU:: 127524
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human GRAP2, aa1-330 (NP_004801.1).
Format:: Supplied as a liquid.
Weitere Details:: Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc. Applications: Suitable for use in Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.