127508-BIOTIN
GPS2 (G-Protein Pathway Suppressor 2, GPS-2, MGC104294, MGC119287, MGC119288, MGC119289) (Biotin)
Größe
£914.00
- SKU:
- 127508-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa228-327 from human GPS2 (AAH13652) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- GPS2 (G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signaling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice