127502-HRP

GPR89 (G-Protein-coupled Receptor 89A, GPR89A, GPR89B, CGI-13, FLJ10492, FLJ11696, FLJ36909, FLJ79270, Golgi pH Regulator A, GPHRA, MGC688, MGC87324, Protein GPR89A, Putative MAPK-activating Protein PM01, Putative NF-kappa-B-activating Protein 90, SH120, UNQ192/PRO218) (HRP)

Größe

£914.00

SKU:: 127502-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa175-285 from human GPR89 (AAH03187) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: GPR89 may be involved in the NF-kappa-B and MAPK signaling pathways Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.