127474-APC

GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, Transaminase A) (APC)

Größe

£927.00

SKU:: 127474-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa331-430 from human GOT2 (NP_002071) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H8
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.