GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31)

Größe

£685.00

SKU:: 127459
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-99 from GOLGA5 (NP_005104) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.