GOLGA2 (Golgin Subfamily A Member 2, 130kD cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672)

Größe

£685.00

SKU:: 127456
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-120 of human GOLGA2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Golgi auto-antigen; probably involved in maintaining cis-Golgi structure. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.